Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID augustus_masked-scaffold06912-abinit-gene-0.2-mRNA-1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family B3
Protein Properties Length: 442aa    MW: 49786.4 Da    PI: 6.8894
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
augustus_masked-scaffold06912-abinit-gene-0.2-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                                           -..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE CS
                                                    B3   5 ltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvl 61 
                                                           l+  +  + + l++p+kf++++g +   s   tl  +sgr W v+l  rk +++ ++
  augustus_masked-scaffold06912-abinit-gene-0.2-mRNA-1  45 LMDVSIIQDKKLRIPNKFVRKFGDE--LSSVATLSVPSGRDWLVEL--RKADQKLWF 97 
                                                           55666677789***********865..7779999************..********* PP

                                                           -TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                                                    B3  62 tkGWkeFvkangLkegDfvvFkldgrsefe 91 
                                                            +GW eFvk + + +g  ++F+++g+s+f 
  augustus_masked-scaffold06912-abinit-gene-0.2-mRNA-1  98 HDGWHEFVKHHCIHAGNLLIFRYEGNSNFD 127
                                                           ************************999883 PP

                                                           E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEE CS
                                                    B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryv 60 
                                                           v++ps+ +k  +l +p +fa+++  +  +s  ++l+ ++g  W v++   + ++++ 
  augustus_masked-scaffold06912-abinit-gene-0.2-mRNA-1 340 VMKPSYIHKGYLLHIPSSFAQKYL-N--RSGSIMLQISDGPWWLVRC--INEGNGTK 391
                                                           7899******************94.3..3346***************..88888899 PP

                                                           E-TTHHHHHHHHT--TT-EEEEEE-SSSE..E..EEE CS
                                                    B3  61 ltkGWkeFvkangLkegDfvvFkldgrse..felvvk 95 
                                                           l++GW+eFv +n L+egD++vF+l+++++   +l+v+
  augustus_masked-scaffold06912-abinit-gene-0.2-mRNA-1 392 LSQGWREFVLDNCLEEGDVCVFELISKEDimLKLKVT 428
                                                           ***********************99765511445555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.14E-2039136IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-2240135IPR015300DNA-binding pseudobarrel domain
CDDcd100177.90E-1741132No hitNo description
PROSITE profilePS5086314.28341134IPR003340B3 DNA binding domain
SMARTSM010196.2E-1042134IPR003340B3 DNA binding domain
PfamPF023621.2E-1347127IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.1E-21330431IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.24E-22331424IPR015300DNA-binding pseudobarrel domain
CDDcd100171.83E-20335431No hitNo description
SMARTSM010195.2E-13336433IPR003340B3 DNA binding domain
PROSITE profilePS5086312.562337431IPR003340B3 DNA binding domain
PfamPF023624.7E-17339428IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-3331743429144B3 domain-containing transcription factor VRN
4i1k_B2e-3331743429144B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ8L3W12e-32VRN1_ARATH; B3 domain-containing transcription factor VRN1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-33B3 family protein